You are asked to recommend an email retrieval protocol for a company's sales team. The sales team needs to access email from various locations and possibly different computers. The sales team does not want to worry about transferring email messages or files back and forth between these computers. Which email protocol is designed for this purpose

Answers

Answer 1

With IMAP4, a mail server can store messages that users can access from different locations and client devices. A POP3 server necessitates the user downloading their email.

Which of the following protocols allows for safe email retrieval?

Email on a remote web server can be accessed from a local client using the Internet Message Access Protocol (IMAP), a mail protocol. The two most often used Internet mail protocols for obtaining emails are IMAP and POP3.

What one of the following protocols do email servers communicate with one another using?

Over the Internet, emails are delivered using the Simple Mail Transfer Protocol (SMTP). Most email clients send messages to the server using this protocol.

To know more about IMAP4 visit :-

https://brainly.com/question/14289109

#SPJ4


Related Questions

Which of the following is NOT a Linux/Unix file or disk management command? a. cfdisk b. xfsdump c. tar d. xterm. d. xterm.

Answers

D. xterm is NOT a Linux/Unix command for managing files or disks.

How do I mount a virtual drive into the file system in Linux?

Enter the following command to manually add the virtual disc drive at the Linux command prompt: echo /proc/scsi/scsi the command "scsi add-single-device host chan id lun." Use the following information to better understand the parameters for the command: host is the host ID. Chan is the name of the SCSI bus.

A Linux file system is a logical grouping of files on a partition or disc drive. A partition in memory is a section of memory that holds a certain collection of data. There might be several memory divisions in our system. Typically, every partition has a file system.

To know more about Linux command, refer:

brainly.com/question/28901720

#SPJ4

how does data help with poverty?

Answers

Answer: Data can help with poverty in a number of ways. For example, data can be used to identify patterns and trends related to poverty, which can inform policy decisions and help policymakers target resources more effectively. Data can also be used to evaluate the effectiveness of poverty reduction programs, allowing governments and organizations to make adjustments and improvements as needed. Additionally, data can be used to better understand the factors that contribute to poverty and design interventions to address those root causes.

26. Universal Containers (UC) has a queue that is used for managing tasks that need to be worked by the UC customer support team. The same team will now be working some of UC's Cases. Which two options should the administrator use to help the support team

Answers

The two options should the administrator use to help the support team are (I) Configure a flow to assign the cases to the queue and (II) Use assignment rules to set the queue as the owner of the case.

A universal container is what?

International distributor of containers, Universal Containers is expanding quickly. The business manufactures all different types of containers, including small postal containers, special equipment packing, and huge cargo shipping containers.

What does Salesforce mean by a universal container?

As a rapidly expanding international supplier of container solutions, Universal Containers creates various scenarios by getting users to consider issues from a business viewpoint and by offering advice on the types of industries and scenarios we will encounter and how to handle them.

To know more about universal container visit:

https://brainly.com/question/30143272

#SPJ4

Tablets (e.g., iPads) and cell phones make extensive use of ________ to store the operating system and applications that are included with the device. RAM Optical memory Flash memory Cache memory

Answers

Tablets (e.g., iPads) and cell phones make extensive use of Flash memory to store the operating system and applications that are included with the device. Flash memory is used to store the operating system and applications on tablets and cell phones.

Flash memory is a type of non-volatile memory that is commonly used in mobile devices such as tablets and cell phones. It is used to store the operating system and applications that come pre-installed on the device. Unlike RAM, flash memory retains its data even when the device is powered off. It is also smaller, more durable, and more power-efficient than a traditional hard drive, making it a suitable choice for mobile devices that have limited space and battery life. Additionally, flash memory is re-writeable, so it can be used to store additional applications and data as the device's storage needs grow.

Learn more about flash memory, here https://brainly.com/question/30134835

#SPJ4

Enter function in cell I6 that determines average salary of all full time employees with at least one dependent

Answers

Answer:

Throughout the below segment, the solution to the given question is provided.

Explanation:

The CELL formulas include context justification quantities or properties as well as return failures when evaluated using such a separate Excel dominant language.This same CELL function returns configuration, positioning, or specific cell data or documentation relating.

The formula is provided below:

⇒  [tex]In \ I6 \ cell \ use =AVERAGEIF(B4:B34,"FT",D5:D34)[/tex]

Do you think employers are impressed with someone who knows how to use Excel? Why or Why not?

Answers

Answer:

Explanation:

Yes, but it depends on who your applying your job for. If it's a computer based job than they will be impressed.

A customer uses an unencrypted wireless network. One of the users has shared a folder for access by any computer. The customer complains that files sometimes appear and disappear from the shared folder. Which of the following statements best describes how to fix the problem

Answers

A parallel, USB, or wireless interface is typically used by home computers to connect to printers. Network cables or wireless interfaces can be used by printers to connect to a network.

What is Common Printer Features?Serial : Single bits of information are moved in a single cycle through serial data transfer. Since dot matrix printers don't need to transport data at fast speeds, a serial connection can be used.Parallel : It is quicker to transport data in parallel than serially. A single cycle of parallel data transfer allows the movement of multiple bits of data. Data can move more quickly to or from the printer thanks to the broader data transfer path than with serial data transfer.Printers and other devices typically have a USB interface. A plug-and-play-compatible computer system will immediately detect and begin the driver installation process when a USB device is connected to it.FireWire : Platform independent high-speed communication bus called FireWire is also referred to as iLinc or IEEE 1394. Digital printers, scanners, hard disks, and other computing equipment can all be connected via FireWire.

To Learn more About wireless interface Refer To:

https://brainly.com/question/28399168

#SPJ4

Provide the type and hexadecimal representation of the following instruction: sw $t1, 32 ($t2) (20pt)

Answers

sw $t1, 32($t2) \ \$$\textbf{From fig 2.5} \\ sw Opcode = 43 = 101011 \ \ Immediate address (16-bit address) = 32 = 0000000000100000 \\ This is an I-Type instruction. \\$$\textbf{From fig 2.14} \\ the value of destination Register $t1 = 9 = 01001 \\ the value of source Register $t2 = 10 = 01010 \\ So, the binary representation is: \\$(1010   1101   0100   1001   0000   0000   0010   0000)_{2}Afterconvertthehex.representationis:Afterconvertthehex.representationis:$$\textbf{0xAD490020}$

To know more about hexadecimal representation visit:

https://brainly.com/question/13041189

#SPJ4

The instruction "sw $t1, 32($t2)" is a MIPS assembly language instruction used in computer architecture.

What is MIPS?

MIPS (Microprocessor without Interlocked Pipeline Stages) is a reduced instruction set computing (RISC) architecture developed by MIPS Technologies.

The MIPS assembly language instruction "sw $t1, 32($t2)" is used in computer architecture. It stores the contents of a register into memory. Here's how to deconstruct the instruction:

The opcode is "sw," which stands for "store word." It instructs the computer to save a 32-bit word to memory.The source register is "$t1". The contents of this register will be stored in memory.The offset is "32". This is the offset in bytes from the $t2 register's base address.The base register is "($t2)". This is the register whose value is added to the offset to determine where the word will be stored in memory.

Thus, the hexadecimal representation of this instruction is given here.

For more details regarding MIPS, visit:

https://brainly.com/question/4196231

#SPJ2

Which of the following is the same as t2 when examining the difference between two groups? a. F b. T c. Cohen's d d. F2. a. F.

Answers

a. F  is the same as t2 when examining the difference between two groups.

What similarities and differences do ANOVA share with a test?

ANOVA is used to compare the means among three or more groups, while the Student's t test is used to compare the means between two groups. First receives a shared P value in an ANOVA. The ANOVA test results with a significant P value for at least one pair where the mean difference was statistically significant.

The F-test is the ratio of the mean squared error between these two groups, and ANOVA separates the within-group variance from the between-group variance.

To know more about ANOVA share, refer;

https://brainly.com/question/14099492

#SPJ4

6. A ____
is included within a document in a cell to perform a particular action when
selected such as starting an email or navigating to a web page.

A. file
B. hyperlink
C. graphic
D. dialog box

Answers

The answer is B hyperlink

Answer:

B. Hyperlink

Explanation:

File is to put documents away in a file that other similar documents are kept in. A metal tool with rough parts that is used for making things smooth by rubbing.

Information that is stored on a computer under its own heading. Cut or shape something using a file.

A box, often made from card, used to keep documents in.

Hyperlink is included within a document in a cell to perform a particular action when selected such as starting an email or navigating to a web page.

Graphics are photographs or other visual representations in a printed publication. The drawings and photographs in the layout of a book.

Dialog box is a small temporary window in a graphical user interface that appears in order to request information from the user; after the information has been provided the user dismisses the box with ‘okay’ or ’cancel’.

Therefore, the correct answer is b. hyperlink.

in sql, you use the ____ command to query a database.

Answers

In SQL, you use the SELECT command to query a database.

The SELECT command is used to retrieve data from one or more tables in a SQL database.

The basic syntax of a SELECT statement is as follows:

SELECT column1, column2, ...

FROM table_name

WHERE some_column = some_value

Here, column1, column2, etc. are the names of the columns that you want to select, table_name is the name of the table that you want to query, and the WHERE clause is used to filter the results based on a certain condition.

The SELECT statement can also be used in combination with other SQL commands, such as JOIN, UNION, and GROUP BY, to retrieve data from multiple tables or to perform more complex queries.

Learn more about the database:

https://brainly.com/question/29412324

the field or fields on which records are sorted is called the sort key. true or false

Answers

True. The report's sort key refers to the field or fields on which records are sorted.

An important sort key is what?

The first sort field, rep number, is referred to as the main sort key (also known as the primary sort key), and the second sort field, customer name, is referred to as the minor sort key when records are sorted by more than one field, such as sorting by rep number and then by customer name (also called the secondary sort key).

In Access, how do you sort numbers?

The Sort & Filter group can be found by clicking the Home tab on the Ribbon. The field can be sorted by choosing the Ascending or Descending command.

To know more about sort key visit :-

https://brainly.com/question/13130958

#SPJ4

In object-oriented analysis, objects possess characteristics called 1. properties 2. orientations 3. classes 4. inheritances

Answers

In object-oriented design, objects possess characteristics called properties, which the object inherits from its class or possesses on its own.

What is object-oriented analysis?

This refers to the term that is used to describe and define the use of object-oriented programming and visual modeling to direct stakeholder communication and product quality during the software development process.

Object-oriented analysis and design is a technological approach for assessing and creating an application, system, or company and hence, they possess properties.

Read more about object-oriented analysis here:

https://brainly.com/question/15016172

#SPJ1

why has base 2 been accepted and used as the basis for computing?​

Answers

Answer:

Binary numbers which are essentially in base 2 has been accepted and used as the basis for computing because they consist of 0s and 1s, which are the only language the computer recognizes and understands.

Explanation:

In Computer science, a bit is a short word for the term binary digit and is primarily the basic (smallest) unit measurement of data or information.

A bit is a logical state which represents a single binary value of either one (1) or zero (0). This ultimately implies that, a single bit in computer science represents a boolean value of;

1. True or ON, which is equal to one (1).

2. False or OFF, which is equal to zero (0).

Machine and assembly are referred to as a low level programming language used in writing software programs or applications with respect to computer hardware and architecture. Machine language is generally written in 0s and 1s, and as such are cryptic in nature, making them unreadable by humans but understandable to computers.

On the other hand, assembly language use commands written in English such as SUB, MOV, ADD, etc.

A binary numbering system represents all numeric values that are to be written in sequences of ones (1s) and zeroes (0s).

Binary numbers which are essentially in base 2 has been accepted and used as the basis for computing because they consist of 0s and 1s, which are the only language the computer recognizes and understands.

lsa package is not signed as expected. this can cause unexpected behavior with credential guard.

Answers

The LSA provides heterogeneous credential management to connect to networks and databases that are not made by Microsoft.

What distinguishes credential guard from LSA protection?

Only trustworthy, privileged programs and processes are permitted access to user secrets or credentials when Credential Guard is enabled. Windows keeps credentials in the Local Security Authority (LSA), a process running in memory, when Credential Guard is not activated.

Credential Guard: Does it safeguard LSA secrets?

The operating system's LSA process communicates with a new component known as the isolated LSA process that stores and safeguards those secrets when Windows Defender Credential Guard is enabled.

Credential Guard: Is it required?

At this time, it is not advised to enable Windows Defender Credential Guard on domain controllers. On domain controllers, Windows Defender Credential Guard can interfere with the compatibility of some applications without adding any additional protection.

To know more about credential guard visit:

https://brainly.com/question/28902859

#SPJ4

hard disk is a sequential data access medium. true or false?​

Answers

My answer is TRUE

Explanation:

Hope it help!!

What type of OS in firmware is designed to manage a specific device like a video game console?
a. network OS
b. client OS
c. workstation OS
d. appliance OS"

Answers

d. The firmware known as Appliance OS is created specifically to manage devices like video game consoles.

What particular program can check a computer for infections?

A class of software called antivirus software is created to stop, spot, and get rid of malware infections on specific computing devices, networks, and IT systems.

An OS for appliances is what?

An software appliances is a software program integrated with just enough JeOS (just enough operating system) to run effectively on server- or virtual machine-based hardware that meets industry standards.

To know more about Appliance OS visit:

https://brainly.com/question/29355582

#SPJ4

state two function of protein in the body

Answers

Answer: They do most of the work in cells and are required for the structure, function, and regulation of the body's tissues and organs.

Explanation:

Review at least two surveys about the use of agile methodologies, such as the annual survey on the state of agile by VersionOne. Also find a critical analysis of these surveys as they are sponsored by companies that sell agile products or surveys. Summarize your findings in a short paper

Answers

The annual survey on the State of Agile by VersionOne has been conducted since 2010.

Put your research findings in a concise paper.It surveys more than 6,000 agile practitioners and executives across different industries and geographic locations. The survey provides valuable insights into the adoption and use of agile methodologies, trends in agile practices, and the challenges and successes of agile teams.A critical analysis of the survey has been conducted by InfoQ, which is sponsored by companies that sell agile products. The analysis concludes that the survey is biased in favor of VersionOne's products, as some of the questions are designed to highlight the features of their products. It also points out that the survey does not include the perspectives of all stakeholders, such as customers and end-users, which limits its usefulness.Another survey on the use of agile methodologies is the annual State of Agile report by Scrum Alliance. The survey provides insights into the adoption and use of agile methodologies, trends in agile practices, and the challenges and successes of agile teams across different industries and geographies. A critical analysis of the survey has been conducted by InfoQ. The analysis points out that the survey is biased in favor of Scrum Alliance's products, as some of the questions are designed to highlight the features of their products. It also highlights the lack of diversity in the data set, which limits its usefulness. Overall, both surveys provide valuable insights into the adoption and use of agile methodologies, but it is important to be aware of the potential bias in the results and lack of diversity in the data set.

To learn more about the use of agile methodologies refer to:

https://brainly.com/question/13668097

#SPJ4

Hyper-Tech Enterprises manufactures mechanical parts used in air conditioning and heating units. The company employs over 300 workers at its Alabama facility. None of the Hyper-Tech employees belong to a union; however, management believes that unionization is in the near future. A representative of a local union has recently visited Hyper-Tech in an attempt to solicit members and have them sign authorization cards. Enough eligible employees have signed authorization cards to petition the NLRB for an election. Hyper-Tech's top executives are considering fighting the unionization efforts. Which of the following, if true, suggests Hyper-Tech has engaged in an unfair labor practice?
a. Hyper-Tech managers prohibited union representatives from soliciting employees who were on duty.
b. Hyper-Tech managers intervened when pro-union employees solicited other employees while both were on duty.
c. Hyper-Tech managers barred nonemployee union representatives from entering the firm's building.
d. Hyper-Tech managers prohibited distribution of union literature in the company cafeteria.

Answers

Answer:

d

Explanation:

The one action listed in the question that would suggest unfair labor practices would be if Hyper-Tech managers prohibited the distribution of union literature in the company cafeteria. This is because a company can prevent employees from partaking in other tasks and getting distracted while on duty. When an employee is on duty they are getting paid to focus and complete their responsibilities. An employer also has the right to prevent non-employee individuals from entering private property such as their facility. What a company cannot do is prevent their employees from deciding what the literature that they want to read or the decisions that they want to make outside of work hours. Therefore, preventing the employees from accepting literature while on their break time would be considered unfair labor practice.

How do I fix The server cannot process the request because it is malformed. It should not be retried

Answers

The browser cache has to be cleaned in order to remedy this. To clear browsing data in Chrome, click the three dots symbol in the top right corner and choose More Tools from the popup menu.

Describe a server:

A computer program or apparatus that offers a service to another computer program and its user, also known as the client, is referred to as a server.

How does a server operate in a data center?

A server lacks a keyboard and screen. And although your computer keeps the files and data you've placed on it, a server keeps all the information related to the websites it hosts and makes it available to all computers and mobile devices—including yours—that need to access those websites.

To know more about server visit:

https://brainly.com/question/7007432

#SPJ4

Robin has been asked to lead training for new technicians at a local PC distributor specializing in gaming PCs. For which one of the following should she not recommend upgraded parts ?
A. High-end cooling
B. A RAID array
C. High-end video
D. Better sound card

Answers

If she doesn't suggest upgrading the parts, one of the following is a RAID array.

Which kind of operating system, and why, is best for a modern computer system?

MS-Windows It has been the standard operating system powering computing systems around the world since Windows 95 up until Windows 10. It is simple to operate and quickly restarts operation. More protection has been added to the most recent versions to protect you and your data.

Which of these three desktop virtualization clients are there?

Desktop-as-a-Service, Remote Desktop Services, and Virtual Desktop Infrastructure (VDI) are the three most prevalent types of desktop virtualization (DaaS).

To know more about RAID array visit :-

https://brainly.com/question/29892509

#SPJ4

class HashTable(): def __init__(self,nbuckets): pass def __len__(self): pass def __setitem__(self, key, value): pass

Answers

To determine the length of the instance attributes, utilize the magic method __len__. Now, the len(s) method internally calls the special method __len__() to return an object's length.

What does Excel properly?

Capitalizes the initial letter of a text string and any additional letters that come after any character other than a letter in the text. lowercase letters are used for all other letters.

Is the constructor _ init ?

Python classes have a reserved method called "__init__". In OOP principles, it is referred to as a constructor. When an object derived from the class is created, this method is called, enabling the class to initialize the attributes of the class.

To know more about Python visit:-

https://brainly.com/question/18502436

#SPJ4

is a special folder with pointers to disk folders that can be in many locations, but will all appear to be in the same library.

Answers

A library is a special folder that contains references to disk folders that can all look to be in the same library but actually can be found in different locations.

Which recovery tool creates restore points which are snapshots of Windows?

A feature of Microsoft® Windows® called System Restore is intended to safeguard and fix software. System Restore creates Restore Points by taking a "snapshot" of a few system files and the Windows registry.

Document folders, also known as filing folders, are office supplies that come in a variety of designs, dimensions, and materials. The manila file folder is the most well-known type. These folders are made of strong, tear-resistant fabrics, making them ideal for carrying lots of papers and documents at once.

System Restore is a useful tool that creates what is known as a "restore point," which is a kind of snapshot of the software, registry, and driver settings on your PC at a certain moment in time. Then, if required, you can take your PC back to that point in time.

To learn more about System restore refer to :

https://brainly.com/question/27960518

#SPJ4

A technician has installed two new drives in one of the computers in the computer lab. Disk1 will be utilized for user and application data. Disk 2 has already been properly configured and has production data on in. The technician has been unable to format the appropriate disk from the command prompt.
The lab requires that Disk1 be a dynamic disk configured with two partitions. The first partition must be 256,000 MB in size and mapped to drive F. The second partition must be 512,000 MB in size and mapped to drive G.
The new partitions must be formatted to ensure that user's files can be secured from other users and that the disk must be configured to account for future redundancy.
Make sure to maintain a consistent file system.
INSTRUCTIONS:
Conduct the necessary steps within the Disk Manager to accomplish these tasks.
If at any time you would like to bring back the initial state of the simulation, please click the Reset All button.

Answers

A user has installed two new drives in one of the computers in the computer lab and has been unable to format Disk1 from the command prompt.

How to installed new drives in computers?Right click on disk 1, click on initializeChoose disk and option as MBR. Hit ok.Again, right click on disk 1 and choose convert to dynamic disk.Now right click on disk 1 and choose new simple volume.Specify storage as 256000 and assign a drive letter F and choose file system as NTFS and click finish.Do the same thing for rest of space of disk 1, assigning 512000MB and using Disc GA user has installed two new drives in one of the computers in the computer lab and has been unable to format Disk1 from the command prompt.The lab requires that Disk1 be a dynamic disk configured with two partitionsThe first partition must be 256,000 MB in size and mapped to drive F. The second partition must be 512,000 MB in size and mapped to drive G. The new partitions must be formatted to ensure that user â €™s files can be secured from other users and that the disk must be configured to account for future redundancy.Make sure to maintain a consistent file system.

To learn more about installed drives refers to;

https://brainly.com/question/14374281

#SPJ4

Can anyone please help answer this question?
What is a multi-dimensional database?

Answers

it’s a base with data that is used to show information

1. What is the maximum achievable end-end throughput (in Mbps) for each of four client-to-server pairs, assuming that the middle link is fair-shared (i. E. , divides its transmission rate equally among the four pairs)

Answers

The greatest end-to-end throughput that can be achieved, according to the query, is 60 Mbps.

How come it's called a server?

They receive functionality from another laptop, device, or application known as a "client," for which they are referred to as such. Server software, file servers, network servers, and database servers are just a few of the several types of servers.

Is a server software or hardware?

A server is made up of hardware, software, or a mix of the two, and it serves as a hub for other computers or programmes to access resources, services, or data. In most cases, a network like the Internet is used to access the server system.

To know more about Server visit :

https://brainly.com/question/7007432

#SPJ4

7) What is the difference between informing the public and influencing the public?

Answers

Answer:

jfutdutixyddixdoxixjxix

Explanation:

yzzixkhckckcoh

Using this week that it would have been a great job in the world to me to have been in business and personal information about a week or more than the average of a single entry was posted on Tuesday that it would

True/False: An algorithm can often be implemented with either recursion or iteration, however recursion is typically faster.

Answers

False. An algorithm can often be implemented with either recursion or iteration, however recursion is typically faster.

Recursive algorithms are they quicker than iterative ones?

Recursion is slower than iteration, which is more effective. Iterative codes are more straightforward to optimize and typically have polynomial time complexity. In data structures like an array, set, map, etc., they are used to repeatedly iterate over the elements.

Why does recursion beat iteration?

When using the divide and conquer strategy, recursion can be used to speed up the process and reduce the size of your problem at each stage. Recursion is often easier to construct than iterative solutions, making it more "elegant".

To know more about recursion visit :-

https://brainly.com/question/30027987

#SPJ4

Describe the ideal location to conduct troubleshooting.

Answers

The ideal location to conduct troubleshooting is to make sure to note that you have not determined the underlying cause and that the repair is just temporary.

What is troubleshooting?

Finding the source of a problem and determining the best course of action to restore it to operation are both steps in the troubleshooting process.

To effectively troubleshoot a problem, the root cause must be found and thoroughly reported in order to prevent the recurrence of the issue.

Therefore, making sure to mention that you have not found the underlying cause and that the repair is only temporary is the optimal place to conduct troubleshooting.

To learn more about troubleshooting, refer to the link:

https://brainly.com/question/30048504

#SPJ1

Other Questions
Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Dan drank 7/8 of a bottle of water During basketball practice. He then drank Another 4/8 of a bottle after practice. How much water did he drink altogether thats The Night is a big black catThe Moon is her topaz eye,The stars are the mice she hunts at night,In the field of the sultry skyIdentify a metaphor from the poem In a storeroom,there are 30 blue balls,48 green balls,some red balls and some white balls. there are 3 times as many green balls as red balls and 5 times as many blue balls as white balls.(a) How many balls are there altogether?(b) How many balls are left in the room if 7/10 (fraction) of the balls are taken away?pls help me answer both You've been asked to write an article for your school newspaper about the pros and cons of homework. What is ironic about this conversation the attorney thinks that there might be valuable evidence in the kitchen while? portia in act 3 is seen to be a typical women of the Elizabethan era. justify Which of the following best describes the beliefs of the Radical Republicans after the Civil War? They worked to pardon all former Confederate leaders. They supported President Johnson without question. They wanted to give former slaves equal rights. They planned to return Southern land back to white owners. How is the text structured in this passage from the prologue sugar changed the world? Anna litic and Noah formula how place a 1.50 kg brick on a wooden board and incline the board at 34.4* above the horziontal. The coefficient of friction between the brick and the board is 0.350. determine the force of gravity, parallel component of gravity and the perpendicular component of gravity. Please also find net force and acceleration