Part A
Which of the following best describes the side chain of arginine at a pH of 11?
nonpolar
uncharged but polar
charged and polar
aprotic
hydrophobic
Charged and polar is incorrect. My textbook says the pKa of the sidechain is 12.48. Can you please explain what the correct answer is?

Answers

Answer 1

At a pH of 11, the side chain of arginine would be positively charged (NH3+) and polar.

This is because the pKa of the guanidine group (NH2) in the side chain of arginine is 12.48, which means that at a pH greater than 12.48, the guanidine group will be protonated and carry a positive charge. Since the nitrogen atom in the guanidine group is also surrounded by hydrogen atoms, the side chain is polar.

Key points:

The side chain of arginine is a guanidine group (NH2).The pKa of the guanidine group is 12.48, which means that at a pH greater than 12.48, the guanidine group will be protonated (NH3+).When protonated, the guanidine group carries a positive charge.The nitrogen atom in the guanidine group is surrounded by hydrogen atoms, which makes the side chain polar in nature.

Learn more about arginine here:

https://brainly.com/question/28368975

#SPJ4


Related Questions

PLS HELP!!!!

The potential energy of the reactants is about
100 kJ
40 kJ
20 kJ
60 kJ

Answers

A and B are the reactants and the potiential energy is 40kj

just read from the graph

How many liters are present in 10 grams of H2O ?

Answers

Answer:

About 0.01

Explanation:

1 grams of H2O = 0.0010

0.0010 x 10 = 0.01

Calculate the mass in grams of 4.96 mol of titanium (Ti).

Answers

The answer is 237.4 grams

What room in a house is similar to the chloroplasts in a cell

Answers

Before we use our imaginations to try and think of a fitting room, let's take a look at what a chloroplast is.

A chloroplast is the organelle in plant-based cells responsible for energy production. Through photosynthesis (you've probably heard of this before!), they use sunlight to create energy for the plant to function.

Since the chloroplast is the energy-maker for the cell, we need to imagine a room in a house that does something like this. There's a couple things that come to my mind. Firstly, although they don't really count as rooms, something like solar panels would probably make the most sense here. Since the answer asks for a room, though, solar panels don't work.

Maybe a kitchen? The kitchen is the room where food is created, supplying energy to all the inhabitants of a house.

I hope this helped! Learning about the components of cells is a little complicated at the start, but it's definitely a very exciting topic that only gets more and more interesting the deeper you delve into it.

- breezy ツ

what is the conservation of mass pertains the chemical change and physical change?

Answers

Answer:

Hey mate......

Explanation:

This is ur answer......

The Law of Conservation of Mass

Matter can change form through physical and chemical changes, but through any of these changes, matter is conserved. The same amount of matter exists before and after the change—none is created or destroyed. This concept is called the Law of Conservation of Mass.

The Law of Conservation of Matter also states that the matter cannot be created or destroyed. In a physical change, substances can change form, but the total mass remains the same. In a chemical change, the total mass of the reactants always equals the total mass of the products.

Hope it helps!

Brainliest pls!

Follow me! :)

Answer:

The Law of Conservation of Matter states that matter cannot be created or destroyed. In a physical change, substances can change form, but the total mass remains the same. In a chemical change, the total mass of the reactants always equals the total mass of the products.

Explanation:

S(s)+3F2(g)->SF6(g) how many mol of F2 are required to react completely with 2.30 mol of S?

Answers

Answer:  There are 6.9 mol of [tex]F_{2}[/tex] are required to react completely with 2.30 mol of S.

Explanation:

The given reaction equation is as follows.

[tex]S(s) + 3F_{2}(g) \rightarrow SF_{6}(g)[/tex]

Here, 1 mole of S is reaction with 3 moles of [tex]F_{2}[/tex] which means 1 mole of S requires 3 moles of [tex]F_{2}[/tex].

Therefore, moles of [tex]F_{2}[/tex] required to react completely with 2.30 moles S are calculated as follows.

[tex]1 mol S = 3 mol F_{2}\\2.30 mol S = 3 mol F_{2} \times 2.30 \\= 6.9 mol F_{2}[/tex]

Thus, we can conclude that there are 6.9 mol of [tex]F_{2}[/tex] are required to react completely with 2.30 mol of S.

1. Do you believe we can bring an end to acid rain? How so?
2. What are some examples of land pollution?

Answers

Answer:

Emissions from Electricity. ...

Vehicle Emissions. ...

Reducing Electricity Consumption. ...

Reducing On-Road Vehicle Exhaust. ...

Other Considerations.

A food worker needs to
measure the temperature of
cold-held potato salad.
Where should she check the
temperature?

Answers

If a food service employee has to check the temperature of cold potato salad, she should do so at multiple places throughout the salad

If the dish is maintained between 40 and 140 degrees Fahrenheit, potato salad can be consumed around two hours after cooking. A nice approach to keep salad fresh for a long time is to refrigerate it at 40 F. Before reaching 140 F, the hot salad can be reheated.

Addition than potatoes, the salad ingredients may contain other ingredients with varying rates of cooling. Therefore, it is necessary to take temperature readings of the potato salad at various locations.

Learn more about the Temperature of refrigerator here:https://brainly.com/question/8148511

The complete question is-

A food worker needs to measure the temperature of cold-held potato salad where should she check the temperature

A. On the surface of the salad

B. Along the side of the salad dish

C. In multiple places throughout the salad

D. On the temperature gauge of the holding equipment

Pls answer. Braniest answer will be picked.

Answers

[tex] \huge\mathrm{ \boxed{A} \boxed{n}\boxed{s}\boxed{w}\boxed{e}\boxed{r}}[/tex]

The Correct option is C.)

Above diagram shows how Sodium and Chlorine forms an Ionic bond.

[tex] \mathrm{2Na + Cl_2 \rightarrow2NaCl }[/tex]

_____________________________

[tex]\mathrm{ \#TeeNForeveR}[/tex]

What is the exact molar mass of aspartame?

Answers

Aspartame, C14H18N2O5, has a molar mass of 294.307 grams/mol. As a result, the molecular weight of aspartame (C14H18N2O5) is equal to the molecular weights of 14 carbon atoms, 18 hydrogen atoms, 2, nitrogen atoms, and 5, oxygen atoms. As a result, aspartame (C14H18N2O5) has a molecular weight of 294.307 g/mol.

You can quickly determine the molar mass of aspartame if you have a periodic table nearby (C14H18N2O5), because combining the molar masses of the constituent atoms yields the molar mass of any molecule (or compound). Aspartic acid is known by the IUPAC name 2-Aminobutanoic acid, and its chemical formula is HOOCCH (NH 2) CH 2 COOH.

Learn more about aspartame here:

https://brainly.com/question/9352908

#SPJ4

Which best describes the velocity of a person on a merry-go-round? * 1 point zero constant increasing continuously changing​

Answers

Answer:

continuously changing

Explanation:

The velocity of a person on a merry-go-round can best be described as continuously changing. This is because the initial velocity before the ride starts would be 0. Once the ride begins, it keeps going faster and faster until it reaches a certain speed. During this time the velocity is increasing. Then it remains constant for a certain period of time and when the ride is over the velocity and speed begins to decrease until ultimately reaching a speed of 0. Therefore, it is continuously changing throughout the duration of the ride.

H_ _t
tis produced from many kinds of fuel. It travels from an area of higher temperature to an area of lower temperature​

Answers

Heat. Heat travels from warm to cold until it eventually reaches equilibrium.

How is Ethyl Butyrate and Isovaleric Acid DIfferent?

Answers

Ethyl butyrate have one oxygen is an Aldehyde and isovaleric Acid have two oxygen is an carboxylic acid

Ethyl Butyrate is an ester with a molecular formula of C₆H₁₂O₂ and  Isovaleric Acid is a carboxylic acid with a molecular formula of C₅H₁₀O₂.

What is an ester?

In chemistry, an ester can be described as a compound derived from an oxoacid in which at least one hydroxyl group (-OH) is replaced by an alkoxy group (-O-R), as in the substitution chemical reaction of a carboxylic acid and an alcohol. But the carboxylic acid contains a carboxyl group (C(=O)OH) attached to an R-group.

Glycerides can be defined as fatty acid esters of glycerol and are one of the main classes of lipids and comprise the bulk of vegetable oils and animal fats.

Esters can be derived from carboxylic acids and are more frequently  IUPAC nomenclature used for esters, based on the name for the acid followed by the suffix "-oate".

The chemical formulas of organic esters generally take the form RCO₂R’, where R and R′ are usually the hydrocarbon parts of the carboxylic acid and the alcohol respectively.

Learn more about Esters, here:

https://brainly.com/question/10840252

#SPJ2

Read the labels of several commercial products and identify monatomic ions of at least four transition elements contained in the products. Write the complete electron configurations of these cations

Answers

As stated in the preceding statement [Zn²] = 1s²2s²2p⁶3s²3p⁶3d¹⁰, [Fe3+] = 1s²2s²2p⁶3s²3p⁶3d⁵, [Fe²⁺] = 1s²2s²2p⁶3s²3p⁶3d⁶, [Cd²⁺] = 1s²2s²2p⁶3s²3p⁶3d¹⁰4s²4p⁶4d¹⁰

What is the straightforward meaning of element?

Denotes to a basic material that isn't divided into smaller components or transformed into another chemical in chemistry. An atom, which is made up of protons, neutrons, and particles, is really the fundamental unit of an element. An element's atoms all equal the number of protons.

Dietary supplements include Zn²⁺ ions:

[Zn²⁺] = 1s²2s²2p⁶3s²3p⁶3d¹⁰

Mineral water contains Fe³⁺ cations:

[Fe3+] = 1s²2s²2p⁶3s²3p⁶3d⁵

Food supplements may include Fe²⁺ cations:

[Fe²⁺] = 1s²2s²2p⁶3s²3p⁶3d⁶

Paints had Cd²⁺ ions in them:

[Cd²⁺] = 1s²2s²2p⁶3s²3p⁶3d¹⁰4s²4p⁶4d¹⁰

To know more about Elements visit:

https://brainly.com/question/28376204

#SPJ4

The complete question is-

Read the labels of several commercial products and identify monatomic ions of at least four transition elements contained in the products.  Write the complete electron configuration of these cations.  Make sure to clearly identify which monatomic ions is found in which commercial product.

An oxygen-binding protein was purified from a mollusk. It was found to exhibit fluorescence, which means that it has amino acid residues that absorb light of one wavelength and then emit light of a longer wavelength. Generally, the more exposed these residues are to solvent, the greater their fluorescence intensity. When placed in a deoxygenated buffer solution, the protein's fluorescence was measured and assigned a value of 1.0. Then the amount of protein fluorescence was measured under various other conditions and expressed relative to the initial measurement. The results are summarized in the table. Which conclusion is supported by these results

Answers

The conclusion is supported by these results is binding of oxygen to the protein changes the protein's tertiary structure to a conformation that resists the effects of urea.

Simple definition of fluorescence

Fluorescence is a property that some chemicals have that allows them to emit visible light after absorbing radiation that is typically invisible, like ultraviolet light.

Fluorescence is the name given to the process of electromagnetic radiation typically visible light emitting from a material as a result of atoms being excited. These excited atoms almost immediately (within 10⁻⁸ seconds) begin emitting again. In most cases, the initial excitation is brought on by the energy absorption of incident radiation or particles, like X-rays or electrons.

To know more about fluorescence visit:

https://brainly.com/question/24228588

#SPJ4

How many neutrons are in an atom of nitrogen-14?

Answers

There are 7 neutrons in an atom of nitrogen-14.

Nitrogen-14 is primarily an isotope of nitrogen, as is well known. We can also describe it as a neutral atom. Additionally, various isotopes typically have a variable ratio of neutrons to protons.

As is common knowledge, an atom's atomic number represents the total number of protons that make up its nucleus. We are informed that nitrogen has a mass number of 14, and we are also aware that nitrogen has an atomic number of 7.

It is discovered that the atomic number and the number of protons are same. This demonstrates that the nucleus of any atom that is an isotope of nitrogen will in general have seven protons.

Additionally, the number of electrons equals the amount of protons. The number of electrons will therefore be 7, we can say. We shall now determine how many neutrons are there. As is well known, mass is equal to the sum of the protons and neutrons. As a result, there will be = 14 - 7 = 7 neutrons.

As a result, we may say that nitrogen-14 has 7 electrons, 7 protons, and 7 neutrons and that it is neither an anion nor a cation. It's an impartial atom.

Learn more about neutron at https://brainly.com/question/29248303

#SPJ4

Solve the following equation for X. Remember to balance the equation. Xe + 2F2 -> X In the above question we see the reaction between Xe and fluorine gas F2. Interestingly, Xenon has a high affinity for oxygen, and xenon fluorides are known to undergo hydrolysis to give the hydrohalic acid and the rare gas oxide similar to the following equation: XeF6 + 3H2O -> X + 6HF

Answers

xenon fluorides are known to undergo hydrolysis to give the hydrohalic acid and the rare gas oxide similar to the following equation: XeF6 + 3H2O -> XeO3 + 6HF.

A noble gas compound with the formula XeF6 is xenon hexafluoride. It is one of xenon's three binary fluorides, along with XeF2 and XeF4. All known are exergonic and stable at normal temperatures. The series' strongest fluorinating agent is XeF6.Water's chemical formula is H2O, which means that each of its molecules consists of two hydrogen atoms and one oxygen atom. In its +6 oxidation state, xenon can form the unstable chemical xenon trioxide(XeO3). It is an extremely potent oxidizing agent that slowly releases oxygen from water, a process that is sped up by sunshine. When it comes into touch with organic materials, it explodes dangerously. It emits xenon and oxygen gas when it explodes.

learn more about xenon trioxide Refer:brainly.com/question/28265574

#SPJ4

Determine the number of atoms of each element in the following: 4Al(OH)3

Answers

symbol

aluminium - Al 4

oxygen- o 12

hydrogen- H 12

How many moles of H3PO4 form from 9 mol P4O10

Answers

According to the given chemical equation and stoichiometry of it , 36 moles of H₃PO₄ are formed from 9 moles of P₄O₁₀.

What is stoichiometry?

It is the determination of proportions of elements or compounds in a chemical reaction. The related relations are based on law of conservation of mass and law of combining weights and volumes.

Stoichiometry is used in quantitative analysis for measuring concentrations of substances present in the sample.

As per the reaction, 1 mole of P₄O₁₀ produces 4 moles of  H₃PO₄, thus 9 moles of  P₄O₁₀ will produce 9×4=36 moles of H₃PO₄.

Thus,36 moles of H₃PO₄ are formed from 9 moles of P₄O₁₀.

Learn more about stoichiometry,here:

https://brainly.com/question/9743981

#SPJ1

Answer:36

Explanation:

taking the class just got it right

Three Chemistry students find a bottle of colorless liquid in the laboratory and each makes a different suggestions about the identity of its contents.
Josh: I think it is a reducing agent.
Matthew: I think it is an oxidizing agent.
Ricchard: I think it is neither a reducing agent nor an oxidizing agent.

Answers

Answer:

and the question is?

Explanation:

Two additional compounds were studied: NO2(OH) dissolved in water and produced an acidic solution, and Ni(OH)2 dissolved only in an acidic solution. What type of compounds were these

Answers

NO2(OH) dissolved in water is an example of an acidic salt.

Acidic salts are formed when a strong acid and a weak base react together. They are acidic in solution because they dissociate to form H+ ions and an anion. In this case, the acidic salt is NO2(OH), which when dissolved in water, dissociates to form H+ ions and OH- ions, resulting in an acidic solution.

Ni(OH)2 dissolved only in an acidic solution is an example of a basic salt.

Basic salts are formed when a strong base and a weak acid react together. They are basic in solution because they dissociate to form hydroxide ions (OH-). In this case, the basic salt is Ni(OH)2, which when dissolved only in an acidic solution will dissociate to form Ni2+ ions and OH- ions resulting in a basic solution.

Learn more about Acidic and Basic Salts here: https://brainly.com/question/7178280

#SPJ4

the reaction between strontium hydroxide and chloric acid produces __________.

Answers

The reaction between strontium hydroxide and hydrochloric acid produces strontium chloride and water.

Estimate the net charge at pH=7. Assume the pKa values given in the table above. Term____

Answers

The net charge at pH=7. The pKa values given in the table above will term is referred as neutral.

At pH = 7, the solution is considered neutral, which means that the concentration of H+ ions is equal to the concentration of OH- ions, i.e [H+] = [OH-] = 10^-7 M.

To estimate the net charge at pH = 7, you would need to know the pKa values of the acid and the species present in the solution.  It is important to note that the net charge at pH 7 will depend on the acid and species present in the solution, and the pKa values given for that specific acid. In a neutral solution, the pH is equal to 7, which means that the concentration of H+ ions is equal to the concentration of OH- ions. Since the pH is neutral, this means that the solution has no net charge. Neutral solutions contain equal concentrations of positive and negative ions, thus the net charge is zero.

To know more about pH please refer: https://brainly.com/question/16926229

#SPJ4

show the shape and appearance of the arrangement of atoms in a compound.

Answers

(I hate these pesky links they are just scams)

I don’t Know if this right but...

Molecular models shows the shape and appearance of the arrangement of atoms in compounds.

(Hope this helps)

Ribose is an important sugar with a molar mass of 150.15 g/mol and an empirical formula of CH2O. What is the molecular formula

Answers

Ribose is an important sugar with a molar mass of 150.15 g/mol and an empirical formula of CH₂O . Its molecular formula is C₅H₁₀O₅

A molecular formula  is defined as the exact number of different atoms present in the molecule of a compound. On the other hand, an empirical formula is defined as the simplest whole number ratio of the different atoms present in a molecule of a compound.

Given here,

molar mass of ribose sugar = 150.15 g/mol

empirical formula = CH₂O

To find: molecular formula

empirical formula mass of ribose sugar

=  (12+ 1×2+ 16) g/mol

= 30 g/mol

molar mass/ empirical formula mass

= 150.15 gmol⁻¹ / 30  gmol⁻¹

=5.005

≈5

we know that

molecular formula

= molar mass/ empirical formula mass  × empirical formula

=5 ×CH₂O

= C₅H₁₀O₅

Thus, the molecular formula is C₅H₁₀O₅

To know more about molecular formula here

https://brainly.com/question/26484895

#SPJ4

When sand and water are mixed in a beaker, the sand is mixed into the water. However, if you stop stirring, the sand will settle down to the bottom. This mixture is a

a
solution
b
suspension
c
colloid
d
solute

Answers

the answer is b) suspension

how many moles of iron (iii) oxide is needed to produce 2 moles of oxegen

Answers

3 moles
Find the moles of 23.1 grams of iron (III) oxide using the molar mass of iron (III) oxide; Convert the moles of iron (III) oxide to moles of O2 using the balanced equation. We see that 3 moles of oxygen are need to produce 2 moles of iron (III) oxide.


Graph the system on a separate sheet of paper and determine the number of solutions it has one solution If it has one
determine its coordinates.
2x + 3y = 12
2x - y = 4

Answers

Graph a set of linear equations.Systems of linear equations and two-variable inequalities will be covered in this part. We'll practice graphing two equations on the same set of axes first, and then we'll examine the many factors to take into account when graphing two linear inequalities on the same set of axes. The methods you've used to graph single linear equations can also be used to graph a system of linear equations. To graph both lines on the same set of axes, we can use tables of values, slope and y-intercept, or x- and y-intercepts.Here the equations is 2x + 3y = 12  , 2x - y = 4Then 3y = 2x-12  , y = -4-2x

To learn more about linear equations refer to:

brainly.com/question/30206248

#SPJ1

|||Good points and Brainliest||| Explain the biological pump
(have at least 3 sentences pls)

Answers

Answer:

The biological pump or the marine carbon pump is the title for multiple processes leading to separation of carbon from multiple sources of water. Biological pumping is partially responsible for the cycling of organic matter. This process can lead to loss of contact between carbon and the atmosphere for thousands of years.

Hope this helped!

Paper chromatography is a process used to separate mixtures of substances into their components. The components are carried by a mobile phase through a stationary phase made of absorbent paper. An investigation analyzed a sample of black ink to determine its components.Which property allows the components to separate

Answers

Because of its simplicity, comparatively low cost, great sensitivity, and rapid separation, TLC is an extensively used analytical method.

Using a thin stationary phase supported by an inert backing, thin layer chromatography (TLC) is a chromatographic technique used to separate the components of a mixture. It can be carried out on an analytical scale to track the development of a reaction or on a preparative scale to purify minute quantities of a chemical. Similar to all chromatography, TLC works on the premise that a chemical will have varying affinities for the mobile and stationary phases, which will influence how quickly it migrates. TLC aims to produce well-defined, well-separated spots.

Learn more about reaction here-

https://brainly.com/question/28984750

#SPJ4

Other Questions
Reaction Paper to any OPM songs. (needed asap) this is hard if u dont kno dont comment Which of the following statements accurately describes President Hayess reaction to the Great Railroad Strike of 1877?President Hayes ordered railroad companies and striking workers to resolve their dispute through peaceful negotiations.President Hayes ordered railroad companies to reverse pay cuts to end the strike.President Hayes promised railroad workers government subsidies as incentives to return to work.President Hayes sent militias and federal troops from town to end the strike. Which three sentences use a reflexive pronoun correctly? Shippers Warehouse initiates a suit against Trans-State Trucking (TST) by filing a complaint. If TST files a motion to dismiss, the firm is asserting that Group of answer choices even if the facts in the complaint are true, TST is not legally liable. the facts in the complaint are not true. even if TST is legally liable, Shippers Warehouse cannot prove it. if the facts are true, Shippers Warehouse has a right to judicial relief. I am asking a qeustion so I can aswer some Are the two triangles similar? Why or why not? What is body mass index and what is it used for ? Identify the infinitive phrase in the following sentence.The new student was the first one to volunteer for the newly formed photography club.Group of answer choicesphotography clubwas the firstnewly formedto volunteer How might confirmation bias affect our ability to judge the accuracy of information found online? what is a difference between mass and volume 87.5 - 23.4 *O 64.1O 110.9054.1 What is the theoretical probability that an even number will be rolled on a number cube? I dont understand and also any fake answers will be reported The US policy against the spread of communism was called The Truman Doctrine. True or False How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story?