I need help pleaseee

I Need Help Pleaseee

Answers

Answer 1

Answer: pushups aching

sit-ups energized

jumping jacks tired

bicycle strong

Explanation: your welcome and yo put you name and date


Related Questions

Why is physical fitness very important how it can help you as a student?

Answers

Answer

Regular physical activity can help children and adolescents improve cardiorespiratory fitness, build strong bones and muscles, control weight, reduce symptoms of anxiety and depression, and reduce the risk of developing health conditions such as: Heart disease.

What is the advantage of choosing goals that are measurable?

Answers

Answer:here;

Explanation:

The benefits of setting goals include greater direction, greater focus, increased productivity, and higher levels of motivation. Setting goals that are specific and measurable can transform your habits, your mindset, your confidence, and your daily actions.

What is the main function of the cardiovascular system during physical activity?


A. The cardiovascular system delivers oxygen and glucose to the working muscles. It also takes carbon dioxide and other wastes away.

B. The cardiovascular system is responsible for cooling the muscles. The cardiovascular system takes the excess heat away.

C. The cardiovascular system is responsible for warming the muscles. The cardiovascular system brings heat from the heart to the muscles.

D. The cardiovascular system delivers carbon dioxide and glucose to the working muscles. It also takes oxygen and other wastes away.

Answers

Answer:A

Explanation:WILD GUESS

The cardiovascular system delivers oxygen and glucose to the working muscles. It also takes carbon dioxide and other wastes away is the main function of the cardiovascular system during physical activity. Correct option is A.

The main function of the cardiovascular system during physical activity is to deliver oxygen and nutrients, such as glucose, to the working muscles to support their increased energy demands. As muscles work harder during exercise, they require more oxygen and glucose for energy production. The cardiovascular system, consisting of the heart, blood vessels, and blood, works to transport oxygen and glucose from the lungs and digestive system, respectively, to the muscles.

Simultaneously, the cardiovascular system is responsible for removing waste products, such as carbon dioxide and lactic acid, from the muscles. These waste products are generated as a result of increased energy production during exercise. The cardiovascular system carries these waste products away from the muscles and delivers them to the lungs (for carbon dioxide) and other elimination organs for excretion.

In summary, the cardiovascular system plays a crucial role in providing the necessary nutrients and oxygen to the working muscles during physical activity while removing waste products to maintain proper muscle function and overall performance.

To know more about cardiovascular system:

https://brainly.com/question/31985573

#SPJ2

The stage during which syphilis begins to attack the heart, blood vessels and central
nervous system is the

Answers

Answer:

Latent Stage

Explanation:

researched

Let Us Try
How Should I cope with stress?
Instruction: Inside the box are strategies of coping up with stress. Identify
whether it is a healthful or unhealthful strategy and write it on the bones
provided belos
Overeating and weight gain. - Sleeping too much
• Accept yourself as you are Exercise and eat regular meals
• Drinking too muchcohol. - Watching endless hours of TV.
• Underer weight loss Visualize and practice feared situations
. Practice consistent discipline. Talk about with problems with others Pls. pa help ako​

Answers

Answer:

Explanation:

Healthy:

- Accept yourslef as you are

- Excercise and eat regular meals

- Practice consistent discipline

- Talk about problems with others

Unhealthy:

- Overeat and weight gain

- Oversleeping

- Drinking too much alcohol

- Watching endless hours of TV

Which of the following structures produces the female gamete?

A. Ovary
B. Cervix
C. Uterus
D. Uterine tube
E. Ampulla

Answers

Answer:

Ovaries

Explanation:

the Female reproductive system that produces gamete are the gonad and But both sexes have gonads: In females the gonads are the ovaries, which make female gametes (eggs).

the answer would be A.) ovary

what is thought to be the closest thing we have to a magic bullet against heart disease?

Answers

Get at least 2.5 hours of physical activity every week (that's only 30 minutes 5 days a week – you can do that!) Eat a healthy diet (try a Mediterranean or DASH plan) Maintain a healthy weight (to calculate your BMI, go here) Watch less than 7 hours of TV per week.

How do fats and lipids affect the texture of food?

Answers

Answer: Fats and oils can alter a food’s appearance by creating a glossy or moist visual texture. The ability of fat to refract light is also responsible for the opaque appearance of milk. Fats also aid in the browning process of many foods.

:)

What lifestyle choices positively affect physical fitness?

Answers

Regular physical exercise, a well-balanced diet, and adequate sleep are all lifestyle choices that have a good impact on physical fitness.

Physical fitness entails the functioning of the lungs and heart as well as the body's muscles. And, because what we do with the bodies affects what we can accomplish with the minds, fitness influences attributes like mental attentiveness and emotional stability to some extent.

The way you live has a big impact on your health, wellness, and fitness. Today's metropolitan lifestyle, in which people do not pause and take some time for themselves, is doing more harm than good to their physical and mental health. Obesity has been linked to a lack of healthy food alternatives in many people of all ages today.

Every day, aim for at least 30 minutes of physical activity. Consider everyday tasks to be a chance to be active. Make time for frequent, intense exercise for further health and fitness advantages.

To know more about the Physical fitness, here

https://brainly.com/question/14338730

#SPJ4

What do you think is the importance of eating healthy foods while doing physical activities how will this help you achieve your fitness goal?

Answers

For optimum health, both exercise and diet are crucial. The key to losing weight is changing your food to create a calorie deficit, and exercise has several advantages that help you keep your results long-term.

What does the term "optimal health" mean?

A state of total physical, mental, & social well-being is referred to as optimal health. By emphasising the holistic approach to reaching your greatest health outcome, promote healthy behaviours. Health for Life and Work.

What kind of health is ideal?

According to one definition, optimum health refers to a person's capacity for maintaining their own physical, emotional, and mental well-being. In other words, it's the health objectives one might reasonably pursue to feel their best.

To know more about optimum health visit:

https://brainly.com/question/29672832

#SPJ4

What is major structure of the cell membrane and a main source of energy while at rest

Answers

Answer:

The principal components of the plasma membrane are lipids (phospholipids and cholesterol), proteins, and carbohydrate groups that are attached to some of the lipids and proteins. A phospholipid is a lipid made of glycerol, two fatty acid tails, and a phosphate-linked head group.The primary function of the plasma membrane is to protect the cell from its surroundings. Composed of a phospholipid bilayer with embedded proteins, the plasma membrane is selectively permeable to ions and organic molecules and regulates the movement of substances in and out of cells.glucose

In addition to being the main source of energy, glucose is utilized in other pathways, such as glycogen and lipid synthesis by hepatocytes.

iready math book grade 7 Norah lives in minnesota .He records the lowest temperature each day for one week what is the mean of the temperature? -7.3°f, -11.2°f, 2.2°f, 0°f, -1.7°f, 3.3°f, 0°f​

Answers

Explanation:

iready math book grade 7 Norah lives in minnesota .He records the lowest temperature each day for one week what is the mean of the temperature? -7.3°f, -11.2°f, 2.2°f, 0°f, -1.7°f, 3.3°f, 0°fAnswer:

Given :-

He records the lowest temperature each day for one week

-7.3°f, -11.2°f, 2.2°f, 0°f, -1.7°f, 3.3°f, 0°f

To Find :-

Mean

Solution :-

Mean = -7.3 +(-11.2) + 2.2 + 0 + (-1.7) + 3.3 + 0/7

Mean = -7.3 - 11.2 + 2.2 - 1.7 + 3.3/7

Mean = -20.2 + 5.5/7

Mean = -14.7/7

Mean = -2.1⁰ F

What are 5 balanced diets?

Answers

Foods from the five dietary groups—starchy carbohydrates, vegetables and fruits protein, dairy, and healthy fats—make up a balanced diet. Each offers the variety of minerals and vitamins that our systems require to function properly.

Which five factors make up a balanced diet?

In order to maintain a healthy body and mind, a well-balanced diet offers vital vitamins, minerals, and nutrients. A nutritious diet can also help prevent a number of diseases and health issues, as well as help you stay active, keep your energy levels up, get a better night's sleep, and function more clearly.

Why not give an example of a balanced diet?

All of the necessary nutrients for the human body are present in a balanced diet. A well-balanced meal must contain a variety of nutrients, including water, fats, proteins, fiber, vitamins, minerals, and carbohydrates. Reduces the disease risk or improves general health is a nutrient-rich, well-balanced diet.

To know more about  balanced diets visit:

https://brainly.com/question/25596307

#SPJ4

What four factors can influence your sense of wellness?

Answers

The four factors can influence your sense of wellness:

PhysicalMentalEmotional Social health

Wellness is the act of following good practice's on a regular basis in order to achieve improved mental and physical results, so that you are flourishing rather than merely surviving.

To understand the significance of wellbeing, one must first understand how it relates to health. The World Health Organization (WHO) defines health as "a condition of complete physical, mental, and social well-being, rather than only the absence of sickness or disability."

Several aspects of daily lifestyle are regarded as components of overall Wellness. They are: social interaction, exercise, diet, sleep, & mindfulness. Every one of them has an effect on your mental and physical well-being. Making easy and healthy decisions on a regular basis will help you reduce stress, have pleasant social relationships, and achieve maximum wellness.

To know more about the Wellness, here

https://brainly.com/question/19631583

#SPJ4

What food for breakfast?

Answers

Answer:

Protein, most likely bacon or ham or even eggs , dairy(milk) wheat (toast) and a fruit.

A pregnant woman’s blood volume increases by how much?

Answers

During pregnancy, the volume of blood in a woman's body increases by a whopping 50 percent
Blood volume increases by 50 percent

4. In some states, repair shops can accept used oil from do-it-yourselfers or ____________. A) HomeownersB) Other shopsC) ManufacturersD) Restaurants

Answers

Answer:

A) Homeowners.

Explanation:

Pollution can be defined as the physical degradation or contamination of the environment through an emission of harmful, poisonous and toxic chemical substances.

In the United States of America, the agency which was established by US Congress and saddled with the responsibility of overseeing all aspects of pollution, environmental clean up, pesticide use, contamination, and hazardous waste spills is the Environmental Protection Agency (EPA). Also, EPA research solutions, policy development, and enforcement of regulations through the resource Conservation and Recovery Act.

In some states, repair shops such as automechanic shops can accept used oil from do-it-yourselfers or Homeowners. Thus, this action would help to mitigate, reduce or prevent the pollution of the environment (society) by individuals fixing their engine oil-related problems themselves.

Generally, any homeowner that fixes or proffer solutions to his or her mechanical problems and other issues by themselves are referred to as do-it-yourselfers.

Nursing assessment of hearing loss in an older adult client includes evaluation of age-related changes, as well as a history of current illnesses and medications. Which of the following factors are associated with ototoxic effects? Select all that apply.
-Bacterial meningitis
-Asthma
-Coronary artery disease
-Diabetes mellitus
-Gentamicin
-Loop diuretics (e.g., Lasix)

Answers

Nursing assessment of hearing loss in older adult client includes evaluation of age-related changes, and history of current illnesses and medications. Factors associated with ototoxic effects are : diabetes mellitus, loop diuretics (e.g., Lasix), bacterial meningitis and Gentamicin.

What is meant by  ototoxic effects?

Some medications damage the ear, resulting in hearing loss, ringing in the ear, or balance disorders and these drugs are said to be ototoxic. There are more than 200 known ototoxic medications in the market today.

Neomycin is the drug that is most toxic to the structure involved in hearing,  cochlea, thus it is recommended for topical use only.

To know more about ototoxic effects, refer

https://brainly.com/question/29514465

#SPJ4

Average salary for cosmetology in ns

Answers

In Halifax, Nova Scotia, a hair stylist can expect to make $33,421. Salary estimates are based on 12 salaries provided by anonymous Hairstylist employees in Halifax.

Does the market for cosmetologists exist?

Barbers, hairdressers, and cosmetologists' total employment is expected to increase by 11% between 2021 and 2031, which is substantially faster than the average for all occupations.

What wage should hairstylists receive?

In London, a hairdresser makes an average salary of £30,456. This represents a 17.6% increase over the national average hairdresser wage. The typical pay for hairdressers in London is 29% lower than the city's typical wage.

To know more about cosmetology here:

brainly.com/question/14069988

#SPJ1

What is mean by renewable and non-renewable resources explain with examples?

Answers

Renewable resources are replaced by natural processes as fast as they are consumed i.e., sunlight, water, wind, and geothermal sources (hot springs and fumaroles). Non-renewable resources exist in fixed amounts and deplete over time i.e., fossil fuels (coal and oil).

Why are non-renewable resources so important?

Non-renewable energy sources include coal, natural gas, oil and nuclear power. Once these resources are depleted, they cannot be replaced. It is a main problem for human being as they rely on them for most of their energy requirements.

Why are renewable resources important?

Energy production that eliminates greenhouse gas emissions from fossil fuels and reduces some types of air pollution. Energy supply diversification and reduced dependency of imported fuels causes development of economy as well as employment via manufacturing, installation, etc.

How some renewable resources become non-renewable?

Water is an example of renewable resource. If water is being used in large quantities for unnecessary purposes by all peoples of the earth, the supply of the water level below the earth is getting scarce by the day, and water is slowly becoming a non-renewable resource.

To learn more about Renewable and Non-renewable resources visit:

https://brainly.com/question/14214221

#SPJ4

HELP PLS ILL GIVE U ALL MY POINTS + BRAINLIEST BRO PLS I SWEAR ITS DUE TMRW

Answers

Answer:

Explanation: differences between mitosis and Meiosis

Tatrads are present

produces four daughter cells

produces chromosomal numbers by 1/2

synopsis and crossing over of homologous  occur

The pancreatic hormone that raises blood sugar levels is called ____

Answers

Answer: c

Explanation:HHS’s

Answer:

Insulin

Explanation:

Im not  r e t.  a.   r  d e d

What are some lifestyle changes?

Answers

Examples of lifestyle changes are eating a healthy diet, increasing physical activity, quitting smoking or limiting alcohol consumption, improving sleep habits, managing stress, improving hygiene, regular medical check-ups and screenings, building and maintaining positive relationships, continual learning, and self-improvement, and giving back to the community.

Some examples of lifestyle changes that can improve overall health and well-being include:

Eating a healthy diet: Adopting a diet that includes a variety of fruits, vegetables, whole grains, lean proteins, and healthy fats.Increasing physical activity: Incorporating regular exercise such as walking, cycling, or going to the gym into your daily routine.Quitting smoking or limiting alcohol consumption: Reducing or eliminating these habits can significantly reduce the risk of chronic diseases.Improving sleep habits: Aiming for 7-9 hours of good quality sleep every night and maintaining a consistent sleep schedule.Managing stress: Finding healthy ways to manage stress, such as meditation, yoga, or exercise.Improving hygiene: Regularly washing hands, brushing teeth, and taking showers.Regular medical check-ups and screenings: Keeping track of your health by visiting the doctor and getting regular screenings.Building and maintaining positive relationships: Cultivating a support network of friends and family.Continual learning and self-improvement: Continually learning new skills and knowledge can improve mental stimulation and employability.Giving back to the community: Volunteering or participating in community service can have a positive impact on physical and mental well-being and can also have a positive impact on the community.

To learn more about lifestyle habits at

https://brainly.com/question/14699556?referrer=searchResults

#SPJ4

What are the 3 lifestyle changes you would make for maintaining a good health and why?

Answers

Anytime and everywhere you can, get some exercise in. If it is safe to do so, consider using the stairs or boarding the bus a stop earlier.

What are the top three elements for healthy health?

So what really are the most crucial elements in achieving optimal health. According to studies, the following five elements have the greatest effects on overall health and wellbeing: Diet, sleep, exercise, posture, and abstinence from alcohol, narcotics, and cigarette use are the first three.

Make healthful meals that you can freeze and eat later when you don't have time to prepare and set aside one day each week for grocery shopping.

Learn more about good health refer

https://brainly.com/question/16330735

#SPJ4

Serious adverse events of special interest following mRNA covid-19 vaccination in randomized trials in adults is?

Answers

The Pfizer and Moderna mRNA COVID-19 vaccinations were associated with an increased risk of severe adverse events of special interest of 10.1 or 15.1 per 10,000 vaccinated, respectively, compared to placebo baselines of 17.6 and 42.2.

Messenger RNA (mRNA) vaccinations include mRNA, a single-stranded RNA molecule which complements DNA. It is produced in the nucleus when RNA polymerase transcribes DNA to produce pre-mRNA. Prior to a COVID-19 pandemic, mRNA vaccines target infectious illnesses such as HIV-1, rabies, Zika, and influenza, as well as mRNA vaccines targeting several hematologic and solid organ cancers, were in clinical trials. Pfizer and BioNTech began developing an mRNA vaccine for SARS-CoV-2 shortly after the COVID-19 pandemic, as did Moderna, the latter in collaboration with the National Institute for Allergy and Infectious Diseases.

Both the Pfizer or Moderna mRNA vaccines were interchangeable and safe to combine. If you received your first dosage from Pfizer, Moderna, or AstraZeneca, it is secure and safe to receive your second dose from either Pfizer or Moderna.

To know more about the Covid-19 vaccination, here

https://brainly.com/question/29189168

#SPJ4

Why does blood taste salty

Answers

Answer:

Blood tastes salty because it has mineral ions. Things like potassium, and calcium and other things. Also blood PH do be a little high, with its level around 7.35–7.45. Hope this helps you

blood is filled with electrolytes (such as Na+, K+, Cl- and etc).

The concentration of blood is 0.9%.

The table salt we consume, constitutes of Na+ and Cl- (in an ionic bond), Which dissociates in aqueous medium to form free ions. This only gives salt its characteristic taste, and by virtue they are present in blood too. So, this should be the reason to your finding.

Hypertension is NOT a type of cardiovascular disease. Please select the best answer from the choices provided.T/F

Answers

False. Hypertension, or high blood pressure, is a condition that occurs when the force of the blood against artery walls increases and becomes too high for the heart to pump efficiently.

It can cause a wide range of health problems, such as heart disease and stroke, but it is not a type of cardiovascular disease. Hypertension is a risk factor for cardiovascular diseases, such as coronary artery disease, congestive heart failure, and cerebrovascular disease, but it is not an actual disease in and of itself.

Hypertension can be managed through lifestyle changes, such as eating a healthy diet, exercising regularly, and quitting smoking, as well as through the use of medications. It is important to monitor and treat hypertension to reduce the risk of developing more serious health problems.

To learn more about Hypertension visit:

https://brainly.com/question/28232601

#SPJ4

Answer: False

Explanation:

Nerve fibers specialized to carry impulses in the central nervous system are insulated by a fatty white sheath of myelin. What is the purpose of the myelin sheath on the axon of a nerve?

A to maximize the speed of transmission

B to connect dendrites to the axon

C to prevent impulses from moving too quickly

Answers

Use gauthmath i can help with any math problem I have instead of waiting for hours on here 3EMB3R use this cod to get extra tickets

Nursing students are reviewing the structure and function of the ears in preparation for class the next day. The students demonstrate understanding of the information when they describe which of the following as a middle ear structure?
1- Auricle
2- Membranous labyrinth
3- Ossicles
4- Organ of Corti

Answers

Nursing students are reviewing the structure and function of the ears, the students demonstrate understanding of the information when they describe the following as a middle ear structure 3) Ossicles.

What are the functions of ossicles?

The ossicles are tiny bones and the smallest in the human body. The ossicles amplify the sound. The tiny stapes bone attaches to oval window that connects the middle ear to inner ear.

The ossicles are tiny bones in the middle ear, that form chain connecting the ear drum (Tympanic membrane, TM) and inner ear. When airborne sound vibrates the TM, ossicles perform an "impedance match" allowing sound energy to be transferred into fluid filled inner ear.

To know more about ossicles, refer

https://brainly.com/question/28645625

#SPJ4

Which is a short-term benefit of increased physical activity?

Weakens your heart
Increase risk of infections
Decreases confidence and well-being
Decreases stress, anxiety, and fatigue

Answers

D. decreases stress anxiety and fatigue
Other Questions
PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Dan drank 7/8 of a bottle of water During basketball practice. He then drank Another 4/8 of a bottle after practice. How much water did he drink altogether thats The Night is a big black catThe Moon is her topaz eye,The stars are the mice she hunts at night,In the field of the sultry skyIdentify a metaphor from the poem In a storeroom,there are 30 blue balls,48 green balls,some red balls and some white balls. there are 3 times as many green balls as red balls and 5 times as many blue balls as white balls.(a) How many balls are there altogether?(b) How many balls are left in the room if 7/10 (fraction) of the balls are taken away?pls help me answer both You've been asked to write an article for your school newspaper about the pros and cons of homework. What is ironic about this conversation the attorney thinks that there might be valuable evidence in the kitchen while? portia in act 3 is seen to be a typical women of the Elizabethan era. justify Which of the following best describes the beliefs of the Radical Republicans after the Civil War? They worked to pardon all former Confederate leaders. They supported President Johnson without question. They wanted to give former slaves equal rights. They planned to return Southern land back to white owners. How is the text structured in this passage from the prologue sugar changed the world? Anna litic and Noah formula how place a 1.50 kg brick on a wooden board and incline the board at 34.4* above the horziontal. The coefficient of friction between the brick and the board is 0.350. determine the force of gravity, parallel component of gravity and the perpendicular component of gravity. Please also find net force and acceleration Circle of circumstances What did the colonists want from the Declaration of Independence?